General Information

  • ID:  hor002379
  • Uniprot ID:  Q99MP5(26-47)
  • Protein name:  Motilin
  • Gene name:  MLN
  • Organism:  Cavia porcellus (Guinea pig)
  • Family:  Motilin family
  • Source:  animal
  • Expression:  Present in the gut mucosa with the exception of the gastric corpus. Also present in medulla oblongata, nucleus of the solitary tract, hypophysis, spinal cord, hypothalamus, and cerebellum but not in the cerebral cortex.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cavia (genus), Caviidae (family), Hystricomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  FVPIFTYSELRRTQEREQNKRL
  • Length:  22(26-47)
  • Propeptide:  MLSRKAVAALLLVHVTAMLASQTEGFVPIFTYSELRRTQEREQNKRLRKSLRVQQRSKAAGRLEPQEVMEEEENGVIKLTAPVEIGVGLSSRQLEKHRAVLEALLSEALPPPSLVFGGQRPVTAAWE
  • Signal peptide:  MLSRKAVAALLLVHVTAMLASQTEG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q99MP5-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002379_AF2.pdbhor002379_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 318592 Formula: C125H200N38O36
Absent amino acids: ACDGHMW Common amino acids: R
pI: 10.43 Basic residues: 5
Polar residues: 5 Hydrophobic residues: 6
Hydrophobicity: -118.64 Boman Index: -8730
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 66.36
Instability Index: 10150.91 Extinction Coefficient cystines: 1490
Absorbance 280nm: 70.95

Literature

  • PubMed ID:  30677392
  • Title:  A Verification Study of Gastrointestinal Motility-Stimulating Action of Guinea-Pig Motilin Using Isolated Gastrointestinal Strips From Rabbits and Guinea-Pigs